SCOPe 2.06: Domain d1c03c_: 1c03 C:

Lineage for d1c03c_ (1c03 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Phosphorelay protein ypd1 [47231] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)

8. Domain d1c03c_: 1c03 C: [16637]

Details for d1c03c_

PDB Entry: 1c03, 2.3 Å

PDB Description: crystal structure of ypd1p (triclinic form)

PDB Compounds: (C:) hypothetical protein ydl235c

SCOPe Domain Sequences for d1c03c_:

Sequence, based on SEQRES records:

>d1c03c_ a.24.10.2 (C:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnlh

Sequence, based on observed residues (ATOM records):

>d1c03c_ a.24.10.2 (C:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikikdensiyliliakalnqsrlefklarielskyyntnlh

Timeline for d1c03c_:

• d1c03c_ first appeared (with stable ids) in SCOP 1.55
  
• d1c03c_ appears in SCOPe 2.05
  
• d1c03c_ appears in SCOPe 2.07
  
• d1c03c_ appears in the current release, SCOPe 2.08