Lineage for d2nuyb_ (2nuy B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 973199Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 973200Protein automated matches [190115] (26 species)
    not a true protein
  7. 973381Species Sulfolobus acidocaldarius [TaxId:330779] [187925] (3 PDB entries)
  8. 973385Domain d2nuyb_: 2nuy B: [166367]
    automated match to d1w37a_
    complexed with mg, pyr

Details for d2nuyb_

PDB Entry: 2nuy (more details), 2.5 Å

PDB Description: 2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius in complex with pyruvate
PDB Compounds: (B:) 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate aldolase

SCOPe Domain Sequences for d2nuyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuyb_ c.1.10.0 (B:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]}
meiispiitpfdkqgkvnvdalkthaknllekgidaifvngttglgpalskdekrqnlna
lydvthklifqvgslnlndvmelvkfsnemdilgvsshspyyfprlpekflakyyeeiar
isshslyiynypaatgydippsilkslpvkgikdtnqdlahsleyklnlpgvkvyngsnt
liyysllsldgvvasftnfipevivkqrdlikqgklddalrlqelinrladilrkygsis
aiyvlvnefqgydvgyprppifpltdeealslkreieplkrkiqelvh

SCOPe Domain Coordinates for d2nuyb_:

Click to download the PDB-style file with coordinates for d2nuyb_.
(The format of our PDB-style files is described here.)

Timeline for d2nuyb_: