Lineage for d2nuya_ (2nuy A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445293Species Sulfolobus acidocaldarius [TaxId:330779] [187925] (3 PDB entries)
  8. 2445296Domain d2nuya_: 2nuy A: [166366]
    automated match to d1w37a_
    complexed with mg, pyr

Details for d2nuya_

PDB Entry: 2nuy (more details), 2.5 Å

PDB Description: 2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius in complex with pyruvate
PDB Compounds: (A:) 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate aldolase

SCOPe Domain Sequences for d2nuya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuya_ c.1.10.0 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]}
meiispiitpfdkqgkvnvdalkthaknllekgidaifvngttglgpalskdekrqnlna
lydvthklifqvgslnlndvmelvkfsnemdilgvsshspyyfprlpekflakyyeeiar
isshslyiynypaatgydippsilkslpvkgikdtnqdlahsleyklnlpgvkvyngsnt
liyysllsldgvvasftnfipevivkqrdlikqgklddalrlqelinrladilrkygsis
aiyvlvnefqgydvgyprppifpltdeealslkreieplkrkiqelvh

SCOPe Domain Coordinates for d2nuya_:

Click to download the PDB-style file with coordinates for d2nuya_.
(The format of our PDB-style files is described here.)

Timeline for d2nuya_: