SCOPe 2.04: Domain d2nuha_: 2nuh A:

Lineage for d2nuha_ (2nuh A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Xylella fastidiosa [TaxId:160492] [187926] (1 PDB entry)

8. Domain d2nuha_: 2nuh A: [166361]
   automated match to d1naqa_
   complexed with imd

Details for d2nuha_

PDB Entry: 2nuh, 1.39 Å

PDB Description: Crystal structure of CutA from the phytopathgen bacterium Xylella fastidiosa

PDB Compounds: (A:) Periplasmic divalent cation tolerance protein

SCOPe Domain Sequences for d2nuha_:

Sequence; same for both SEQRES and ATOM records:

>d2nuha_ d.58.5.2 (A:) Cut A1 {Xylella fastidiosa [TaxId: 160492]}
sdvylifstcpdlpsaeiisrvlvqerlaacvtqlpgavstyrwqgkiettqeiqllikt
navhvnaaitrlcalhpyrlpeaiavqvsvglpeyltwinteid

Timeline for d2nuha_:

• d2nuha_ first appeared in SCOPe 2.01
  
• d2nuha_ appears in SCOPe 2.03
  
• d2nuha_ appears in SCOPe 2.05
  
• d2nuha_ appears in the current release, SCOPe 2.08