Lineage for d2nuha_ (2nuh A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2517991Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2517992Protein Cut A1 [89931] (5 species)
  7. 2518069Species Xylella fastidiosa [TaxId:160492] [187926] (1 PDB entry)
  8. 2518070Domain d2nuha_: 2nuh A: [166361]
    automated match to d1naqa_
    complexed with imd

Details for d2nuha_

PDB Entry: 2nuh (more details), 1.39 Å

PDB Description: Crystal structure of CutA from the phytopathgen bacterium Xylella fastidiosa
PDB Compounds: (A:) Periplasmic divalent cation tolerance protein

SCOPe Domain Sequences for d2nuha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuha_ d.58.5.2 (A:) Cut A1 {Xylella fastidiosa [TaxId: 160492]}
sdvylifstcpdlpsaeiisrvlvqerlaacvtqlpgavstyrwqgkiettqeiqllikt
navhvnaaitrlcalhpyrlpeaiavqvsvglpeyltwinteid

SCOPe Domain Coordinates for d2nuha_:

Click to download the PDB-style file with coordinates for d2nuha_.
(The format of our PDB-style files is described here.)

Timeline for d2nuha_: