Lineage for d2ntqa_ (2ntq A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962283Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962284Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 962381Family b.80.1.5: Pectin methylesterase [51147] (2 proteins)
    this is a repeat family; one repeat unit is 1qjv A:170-291 found in domain
  6. 962388Protein automated matches [190742] (2 species)
    not a true protein
  7. 962389Species Erwinia chrysanthemi [TaxId:198628] [187923] (7 PDB entries)
  8. 962398Domain d2ntqa_: 2ntq A: [166356]
    automated match to d1qjva_

Details for d2ntqa_

PDB Entry: 2ntq (more details), 1.8 Å

PDB Description: crystal structure of pectin methylesterase in complex with hexasaccharide vii
PDB Compounds: (A:) Pectinesterase A

SCOPe Domain Sequences for d2ntqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntqa_ b.80.1.5 (A:) automated matches {Erwinia chrysanthemi [TaxId: 198628]}
attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
ffeyksygagatvskdrrqltdaqaaeytqskvlgdwtptlp

SCOPe Domain Coordinates for d2ntqa_:

Click to download the PDB-style file with coordinates for d2ntqa_.
(The format of our PDB-style files is described here.)

Timeline for d2ntqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ntqb_