Lineage for d2ntba_ (2ntb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806195Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806196Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 1806294Family b.80.1.5: Pectin methylesterase [51147] (2 proteins)
    automatically mapped to Pfam PF01095
    this is a repeat family; one repeat unit is 1qjv A:170-291 found in domain
  6. 1806301Protein automated matches [190742] (2 species)
    not a true protein
  7. 1806302Species Erwinia chrysanthemi [TaxId:198628] [187923] (7 PDB entries)
  8. 1806313Domain d2ntba_: 2ntb A: [166352]
    automated match to d1qjva_

Details for d2ntba_

PDB Entry: 2ntb (more details), 1.8 Å

PDB Description: crystal structure of pectin methylesterase in complex with hexasaccharide v
PDB Compounds: (A:) Pectinesterase A

SCOPe Domain Sequences for d2ntba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntba_ b.80.1.5 (A:) automated matches {Erwinia chrysanthemi [TaxId: 198628]}
attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
ffeyksygagatvskdrrqltdaqaaeytqskvlgdwtptlp

SCOPe Domain Coordinates for d2ntba_:

Click to download the PDB-style file with coordinates for d2ntba_.
(The format of our PDB-style files is described here.)

Timeline for d2ntba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ntbb_