Lineage for d1c03a_ (1c03 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311859Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2311867Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2311880Protein Phosphorelay protein ypd1 [47231] (2 species)
  7. 2311881Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)
  8. 2311894Domain d1c03a_: 1c03 A: [16635]

Details for d1c03a_

PDB Entry: 1c03 (more details), 2.3 Å

PDB Description: crystal structure of ypd1p (triclinic form)
PDB Compounds: (A:) hypothetical protein ydl235c

SCOPe Domain Sequences for d1c03a_:

Sequence, based on SEQRES records: (download)

>d1c03a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnlh

Sequence, based on observed residues (ATOM records): (download)

>d1c03a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikikdensiyliliakalnqsrlefklarielskyyntnlh

SCOPe Domain Coordinates for d1c03a_:

Click to download the PDB-style file with coordinates for d1c03a_.
(The format of our PDB-style files is described here.)

Timeline for d1c03a_: