Lineage for d2nt2c_ (2nt2 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991569Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 991570Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 991850Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 991851Protein automated matches [190475] (1 species)
    not a true protein
  7. 991852Species Human (Homo sapiens) [TaxId:9606] [187400] (19 PDB entries)
  8. 991869Domain d2nt2c_: 2nt2 C: [166345]
    automated match to d1m3ga_
    complexed with so4

Details for d2nt2c_

PDB Entry: 2nt2 (more details), 2.1 Å

PDB Description: crystal structure of slingshot phosphatase 2
PDB Compounds: (C:) Protein phosphatase Slingshot homolog 2

SCOPe Domain Sequences for d2nt2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nt2c_ c.45.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sptqifehvflgsewnasnledlqnrgvryilnvtreidnffpgvfeyhnirvydeeatd
llaywndtykfiskakkhgskclvhskmgvsrsastviayamkeygwnldraydyvkerr
tvtkpnpsfmrqleeyqgilla

SCOPe Domain Coordinates for d2nt2c_:

Click to download the PDB-style file with coordinates for d2nt2c_.
(The format of our PDB-style files is described here.)

Timeline for d2nt2c_: