SCOPe 2.06: Domain d2nstb_: 2nst B:

Lineage for d2nstb_ (2nst B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.5: Pectin methylesterase [51147] (2 proteins)
   automatically mapped to Pfam PF01095
   this is a repeat family; one repeat unit is 1qjv A:170-291 found in domain

6. Protein automated matches [190742] (2 species)
   not a true protein

7. Species Erwinia chrysanthemi [TaxId:198628] [187923] (7 PDB entries)

8. Domain d2nstb_: 2nst B: [166342]
   automated match to d1qjva_
   mutant

Details for d2nstb_

PDB Entry: 2nst, 1.7 Å

PDB Description: crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide ii

PDB Compounds: (B:) Pectinesterase A

SCOPe Domain Sequences for d2nstb_:

Sequence; same for both SEQRES and ATOM records:

>d2nstb_ b.80.1.5 (B:) automated matches {Erwinia chrysanthemi [TaxId: 198628]}
attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
dsskikdtqavalyvtksgdrayfkdvslvgyqatlyvsggrsffsdcrisgtvdfifgd
gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
ffeyksygagatvskdrrqltdaqaaeytqskvlgdwtptlp

Timeline for d2nstb_:

• d2nstb_ first appeared in SCOPe 2.01
  
• d2nstb_ appears in SCOPe 2.05
  
• d2nstb_ appears in SCOPe 2.07
  
• d2nstb_ appears in the current release, SCOPe 2.08