SCOPe 2.07: Domain d1c02b_: 1c02 B:

Lineage for d1c02b_ (1c02 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Phosphorelay protein ypd1 [47231] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)

8. Domain d1c02b_: 1c02 B: [16634]

Details for d1c02b_

PDB Entry: 1c02, 1.8 Å

PDB Description: crystal structure of yeast ypd1p

PDB Compounds: (B:) phosphotransferase ypd1p

SCOPe Domain Sequences for d1c02b_:

Sequence; same for both SEQRES and ATOM records:

>d1c02b_ a.24.10.2 (B:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmqhffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

Timeline for d1c02b_:

• d1c02b_ first appeared (with stable ids) in SCOP 1.55
  
• d1c02b_ appears in SCOPe 2.06
  
• d1c02b_ appears in the current release, SCOPe 2.08