Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Thunnus atlanticus [TaxId:48168] [187921] (8 PDB entries) |
Domain d2nrma_: 2nrm A: [166334] automated match to d1myta_ complexed with gol, hem |
PDB Entry: 2nrm (more details), 1.09 Å
SCOPe Domain Sequences for d2nrma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrma_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]} adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg qtalrnvmgiiiadleanykelgfsg
Timeline for d2nrma_: