Lineage for d2nrma_ (2nrm A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255628Protein automated matches [190359] (36 species)
    not a true protein
  7. 1255901Species Thunnus atlanticus [TaxId:48168] [187921] (8 PDB entries)
  8. 1255909Domain d2nrma_: 2nrm A: [166334]
    automated match to d1myta_
    complexed with gol, hem

Details for d2nrma_

PDB Entry: 2nrm (more details), 1.09 Å

PDB Description: s-nitrosylated blackfin tuna myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2nrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrma_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]}
adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
qtalrnvmgiiiadleanykelgfsg

SCOPe Domain Coordinates for d2nrma_:

Click to download the PDB-style file with coordinates for d2nrma_.
(The format of our PDB-style files is described here.)

Timeline for d2nrma_: