Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Bacillus sp. [TaxId:1409] [188250] (1 PDB entry) |
Domain d2nqyb_: 2nqy B: [166331] automated match to d1h4ga_ complexed with xyp |
PDB Entry: 2nqy (more details), 2.4 Å
SCOPe Domain Sequences for d2nqyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqyb_ b.29.1.11 (B:) automated matches {Bacillus sp. [TaxId: 1409]} eivtdnstgnhdgydyefwkdsggsgtmilnsggtfsaswssvsnilfrkgkkfnetqth qqvgnmsisyganfqpsgnaylcvygwtvsplveyyivdswgnwrppgatpkgtitvdgg tydiyetdrtnqpsikgvatfsqywstrrskrtsgtisvsnhfraweslgmnmgdmyeva ltvegyqssgsanvysntlringnpl
Timeline for d2nqyb_: