SCOPe 2.08: Domain d2nqyb_: 2nqy B:

Lineage for d2nqyb_ (2nqy B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Bacillus sp. [TaxId:1409] [188250] (1 PDB entry)

8. Domain d2nqyb_: 2nqy B: [166331]
   automated match to d1h4ga_
   complexed with xyp

Details for d2nqyb_

PDB Entry: 2nqy, 2.4 Å

PDB Description: crystal structure of alkaline thermophlic xylanase from bacillus sp. (ncl 86-6-10) with complex xylotriose: xylotriose cleaved to xylobiose and xylose

PDB Compounds: (B:) family 11 xylanase

SCOPe Domain Sequences for d2nqyb_:

Sequence; same for both SEQRES and ATOM records:

>d2nqyb_ b.29.1.11 (B:) automated matches {Bacillus sp. [TaxId: 1409]}
eivtdnstgnhdgydyefwkdsggsgtmilnsggtfsaswssvsnilfrkgkkfnetqth
qqvgnmsisyganfqpsgnaylcvygwtvsplveyyivdswgnwrppgatpkgtitvdgg
tydiyetdrtnqpsikgvatfsqywstrrskrtsgtisvsnhfraweslgmnmgdmyeva
ltvegyqssgsanvysntlringnpl

Timeline for d2nqyb_:

• d2nqyb_ first appeared in SCOPe 2.01
  
• d2nqyb_ appears in SCOPe 2.07