SCOPe 2.08: Domain d2nqya_: 2nqy A:

Lineage for d2nqya_ (2nqy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Bacillus sp. [TaxId:1409] [188250] (1 PDB entry)

8. Domain d2nqya_: 2nqy A: [166330]
   automated match to d1h4ga_
   complexed with xyp

Details for d2nqya_

PDB Entry: 2nqy, 2.4 Å

PDB Description: crystal structure of alkaline thermophlic xylanase from bacillus sp. (ncl 86-6-10) with complex xylotriose: xylotriose cleaved to xylobiose and xylose

PDB Compounds: (A:) family 11 xylanase

SCOPe Domain Sequences for d2nqya_:

Sequence; same for both SEQRES and ATOM records:

>d2nqya_ b.29.1.11 (A:) automated matches {Bacillus sp. [TaxId: 1409]}
eivtdnstgnhdgydyefwkdsggsgtmilnsggtfsaswssvsnilfrkgkkfnetqth
qqvgnmsisyganfqpsgnaylcvygwtvsplveyyivdswgnwrppgatpkgtitvdgg
tydiyetdrtnqpsikgvatfsqywstrrskrtsgtisvsnhfraweslgmnmgdmyeva
ltvegyqssgsanvysntlringnpl

Timeline for d2nqya_:

• d2nqya_ first appeared in SCOPe 2.01
  
• d2nqya_ appears in SCOPe 2.07