Lineage for d2nqya_ (2nqy A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374612Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2374793Protein automated matches [190135] (15 species)
    not a true protein
  7. 2374800Species Bacillus sp. [TaxId:1409] [188250] (1 PDB entry)
  8. 2374801Domain d2nqya_: 2nqy A: [166330]
    automated match to d1h4ga_
    complexed with bxp, xyp

Details for d2nqya_

PDB Entry: 2nqy (more details), 2.4 Å

PDB Description: crystal structure of alkaline thermophlic xylanase from bacillus sp. (ncl 86-6-10) with complex xylotriose: xylotriose cleaved to xylobiose and xylose
PDB Compounds: (A:) family 11 xylanase

SCOPe Domain Sequences for d2nqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqya_ b.29.1.11 (A:) automated matches {Bacillus sp. [TaxId: 1409]}
eivtdnstgnhdgydyefwkdsggsgtmilnsggtfsaswssvsnilfrkgkkfnetqth
qqvgnmsisyganfqpsgnaylcvygwtvsplveyyivdswgnwrppgatpkgtitvdgg
tydiyetdrtnqpsikgvatfsqywstrrskrtsgtisvsnhfraweslgmnmgdmyeva
ltvegyqssgsanvysntlringnpl

SCOPe Domain Coordinates for d2nqya_:

Click to download the PDB-style file with coordinates for d2nqya_.
(The format of our PDB-style files is described here.)

Timeline for d2nqya_: