Lineage for d1c02a_ (1c02 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313536Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2313544Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2313557Protein Phosphorelay protein ypd1 [47231] (2 species)
  7. 2313558Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)
  8. 2313559Domain d1c02a_: 1c02 A: [16633]

Details for d1c02a_

PDB Entry: 1c02 (more details), 1.8 Å

PDB Description: crystal structure of yeast ypd1p
PDB Compounds: (A:) phosphotransferase ypd1p

SCOPe Domain Sequences for d1c02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c02a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmqhffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

SCOPe Domain Coordinates for d1c02a_:

Click to download the PDB-style file with coordinates for d1c02a_.
(The format of our PDB-style files is described here.)

Timeline for d1c02a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c02b_