Lineage for d1c02a_ (1c02 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2420Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (2 families) (S)
  5. Family a.24.10.2: Phosphorelay protein ypd1 [47230] (1 protein)
  6. Protein Phosphorelay protein ypd1 [47231] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (3 PDB entries)
  8. Domain d1c02a_: 1c02 A: [16633]

Details for d1c02a_

PDB Entry: 1c02 (more details), 1.8 Å

PDB Description: crystal structure of yeast ypd1p

SCOP Domain Sequences for d1c02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c02a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae)}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmqhffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

SCOP Domain Coordinates for d1c02a_ are not available.

Timeline for d1c02a_:

Domains from other chains:
(mouse over for more information)
d1c02b_