Lineage for d2nqjb_ (2nqj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088840Family c.1.15.1: Endonuclease IV [51659] (2 protein domains)
  6. 2088841Protein Endonuclease IV [51660] (2 species)
    DNA repair enzyme
  7. 2088844Species Escherichia coli [TaxId:562] [51661] (5 PDB entries)
  8. 2088850Domain d2nqjb_: 2nqj B: [166329]
    automated match to d1qtwa_
    complexed with zn; mutant

Details for d2nqjb_

PDB Entry: 2nqj (more details), 2.45 Å

PDB Description: Crystal structure of Escherichia coli endonuclease IV (Endo IV) E261Q mutant bound to damaged DNA
PDB Compounds: (B:) Endonuclease 4

SCOPe Domain Sequences for d2nqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqjb_ c.1.15.1 (B:) Endonuclease IV {Escherichia coli [TaxId: 562]}
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgiplilqtinpdiwaeeiawlkaqq

SCOPe Domain Coordinates for d2nqjb_:

Click to download the PDB-style file with coordinates for d2nqjb_.
(The format of our PDB-style files is described here.)

Timeline for d2nqjb_: