Lineage for d2nqha_ (2nqh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839045Family c.1.15.1: Endonuclease IV [51659] (2 proteins)
  6. 2839046Protein Endonuclease IV [51660] (2 species)
    DNA repair enzyme
  7. 2839049Species Escherichia coli [TaxId:562] [51661] (5 PDB entries)
  8. 2839050Domain d2nqha_: 2nqh A: [166327]
    automated match to d1qtwa_
    complexed with po4, zn; mutant

Details for d2nqha_

PDB Entry: 2nqh (more details), 1.1 Å

PDB Description: high resolution crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant
PDB Compounds: (A:) Endonuclease 4

SCOPe Domain Sequences for d2nqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqha_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]}
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgiplilqtinpdiwaeeiawlkaqq

SCOPe Domain Coordinates for d2nqha_:

Click to download the PDB-style file with coordinates for d2nqha_.
(The format of our PDB-style files is described here.)

Timeline for d2nqha_: