Lineage for d2npac_ (2npa C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2008945Domain d2npac_: 2npa C: [166325]
    automated match to d1i7ga_
    complexed with mmb

Details for d2npac_

PDB Entry: 2npa (more details), 2.3 Å

PDB Description: the crystal structure of the human pparaplpha ligand binding domain in complex with a a-hydroxyimino phenylpropanoic acid
PDB Compounds: (C:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d2npac_:

Sequence, based on SEQRES records: (download)

>d2npac_ a.123.1.1 (C:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
etadlkslakriyeaylknfnmnkvkarvilsgaasnnppfvihdmetlcmaektlvakl
vangiqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaif
amlssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislf
vaaiiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvt
ehaqlvqiikktesdaalhpllqeiyrdmy

Sequence, based on observed residues (ATOM records): (download)

>d2npac_ a.123.1.1 (C:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
etadlkslakriyeaylknfnmnkvkarvilsgaasnnppfvihdmetlcmaektlvakl
viqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifaml
ssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaa
iiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvteha
qlvqiikktesdaalhpllqeiyrdmy

SCOPe Domain Coordinates for d2npac_:

Click to download the PDB-style file with coordinates for d2npac_.
(The format of our PDB-style files is described here.)

Timeline for d2npac_: