Lineage for d1bdjb_ (1bdj B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46463Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)
  4. 46662Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families) (S)
  5. 46663Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein)
  6. 46664Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species)
  7. 46665Species Escherichia coli [TaxId:562] [47229] (4 PDB entries)
  8. 46668Domain d1bdjb_: 1bdj B: [16632]
    Other proteins in same PDB: d1bdja_

Details for d1bdjb_

PDB Entry: 1bdj (more details), 2.68 Å

PDB Description: complex structure of hpt domain and chey

SCOP Domain Sequences for d1bdjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdjb_ a.24.10.1 (B:) Aerobic respiration control sensor protein, ArcB {Escherichia coli}
ksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghki
kgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat

SCOP Domain Coordinates for d1bdjb_:

Click to download the PDB-style file with coordinates for d1bdjb_.
(The format of our PDB-style files is described here.)

Timeline for d1bdjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bdja_