Lineage for d2nnwd_ (2nnw D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145290Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
    automatically mapped to Pfam PF01269
  6. 2145291Protein Fibrillarin homologue [53343] (4 species)
  7. 2145297Species Pyrococcus furiosus [TaxId:2261] [224904] (3 PDB entries)
  8. 2145300Domain d2nnwd_: 2nnw D: [166315]
    automated match to d1prya_

Details for d2nnwd_

PDB Entry: 2nnw (more details), 2.7 Å

PDB Description: Alternative conformations of Nop56/58-fibrillarin complex and implication for induced-fit assenly of box C/D RNPs
PDB Compounds: (D:) Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase

SCOPe Domain Sequences for d2nnwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnwd_ c.66.1.3 (D:) Fibrillarin homologue {Pyrococcus furiosus [TaxId: 2261]}
mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklga
aivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpivee
rrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavks
rsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp

SCOPe Domain Coordinates for d2nnwd_:

Click to download the PDB-style file with coordinates for d2nnwd_.
(The format of our PDB-style files is described here.)

Timeline for d2nnwd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nnwb_