SCOPe 2.07: Domain d1a0ba_: 1a0b A:

Lineage for d1a0ba_ (1a0b A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein)

6. Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species)

7. Species Escherichia coli [TaxId:562] [47229] (4 PDB entries)

8. Domain d1a0ba_: 1a0b A: [16631]
   complexed with zn

Details for d1a0ba_

PDB Entry: 1a0b, 2.06 Å

PDB Description: histidine-containing phosphotransfer domain of arcb from escherichia coli

PDB Compounds: (A:) aerobic respiration control sensor protein arcb

SCOPe Domain Sequences for d1a0ba_:

Sequence; same for both SEQRES and ATOM records:

>d1a0ba_ a.24.10.1 (A:) Aerobic respiration control sensor protein, ArcB {Escherichia coli [TaxId: 562]}
ksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghki
kgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat

Timeline for d1a0ba_:

• d1a0ba_ first appeared (with stable ids) in SCOP 1.55, called d1a0b__
  
• d1a0ba_ appears in SCOPe 2.06
  
• d1a0ba_ appears in the current release, SCOPe 2.08