Lineage for d1a0b__ (1a0b -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies) 
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families) 
Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein) Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species) Species Escherichia coli [TaxId:562] [47229] (4 PDB entries) 
Domain d1a0b__: 1a0b - [16631]
Details for d1a0b__
PDB Entry: 1a0b (more details), 2.06 Å
PDB Description: histidine-containing phosphotransfer domain of arcb from escherichia coli
SCOP Domain Sequences for d1a0b__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0b__ a.24.10.1 (-) Aerobic respiration control sensor protein, ArcB {Escherichia coli}
ksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghki
kgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat
SCOP Domain Coordinates for d1a0b__:
Click to download the PDB-style file with coordinates for d1a0b__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a0b__:
- d1a0b__ first appeared (with stable ids) in SCOP 1.55
- d1a0b__ appears in SCOP 1.59
- d1a0b__ appears in the current release, SCOPe 2.08, called d1a0ba_
View in 3D