SCOPe 2.04: Domain d2nmsa_: 2nms A:

Lineage for d2nmsa_ (2nms A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2nmsa_: 2nms A: [166307]
   automated match to d1xeda_

Details for d2nmsa_

PDB Entry: 2nms, 2.6 Å

PDB Description: The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1

PDB Compounds: (A:) CMRF35-like-molecule 1

SCOPe Domain Sequences for d2nmsa_:

Sequence; same for both SEQRES and ATOM records:

>d2nmsa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipqitgpttvnglergsltvqcvyrsgwetylkwwcrgaiwrdckilvktsgseqevkr
drvsikdnqknrtftvtmedlmktdadtywcgiektgndlgvtvqvtidpap

Timeline for d2nmsa_:

• d2nmsa_ first appeared in SCOPe 2.01
  
• d2nmsa_ appears in SCOPe 2.03
  
• d2nmsa_ appears in SCOPe 2.05
  
• d2nmsa_ appears in the current release, SCOPe 2.08, called d2nmsa1