Lineage for d2nmsa_ (2nms A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935707Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 935708Protein automated matches [190740] (5 species)
    not a true protein
  7. 935720Species Human (Homo sapiens) [TaxId:9606] [187920] (4 PDB entries)
  8. 935723Domain d2nmsa_: 2nms A: [166307]
    automated match to d1xeda_

Details for d2nmsa_

PDB Entry: 2nms (more details), 2.6 Å

PDB Description: The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1
PDB Compounds: (A:) CMRF35-like-molecule 1

SCOPe Domain Sequences for d2nmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nmsa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipqitgpttvnglergsltvqcvyrsgwetylkwwcrgaiwrdckilvktsgseqevkr
drvsikdnqknrtftvtmedlmktdadtywcgiektgndlgvtvqvtidpap

SCOPe Domain Coordinates for d2nmsa_:

Click to download the PDB-style file with coordinates for d2nmsa_.
(The format of our PDB-style files is described here.)

Timeline for d2nmsa_: