SCOPe 2.08: Domain d2nmsa1: 2nms A:21-129

Lineage for d2nmsa1 (2nms A:21-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2nmsa1: 2nms A:21-129 [166307]
   Other proteins in same PDB: d2nmsa2
   automated match to d1xeda_

Details for d2nmsa1

PDB Entry: 2nms, 2.6 Å

PDB Description: The Crystal Structure of the Extracellular Domain of the Inhibitor Receptor Expressed on Myeloid Cells IREM-1

PDB Compounds: (A:) CMRF35-like-molecule 1

SCOPe Domain Sequences for d2nmsa1:

Sequence; same for both SEQRES and ATOM records:

>d2nmsa1 b.1.1.0 (A:21-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qitgpttvnglergsltvqcvyrsgwetylkwwcrgaiwrdckilvktsgseqevkrdrv
sikdnqknrtftvtmedlmktdadtywcgiektgndlgvtvqvtidpap

Timeline for d2nmsa1:

• d2nmsa1 first appeared in SCOPe 2.01, called d2nmsa_
  
• d2nmsa1 appears in SCOPe 2.07