Lineage for d2a0b__ (2a0b -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) 
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (2 families) 
Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein) Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species) Species Escherichia coli [TaxId:562] [47229] (3 PDB entries) 
Domain d2a0b__: 2a0b - [16630]
Details for d2a0b__
PDB Entry: 2a0b (more details), 1.57 Å
PDB Description: histidine-containing phosphotransfer domain of arcb from escherichia coli
SCOP Domain Sequences for d2a0b__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a0b__ a.24.10.1 (-) Aerobic respiration control sensor protein, ArcB {Escherichia coli}
sksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghk
ikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat
SCOP Domain Coordinates for d2a0b__:
Click to download the PDB-style file with coordinates for d2a0b__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a0b__:
- d2a0b__ appears in SCOP 1.57
- d2a0b__ appears in the current release, SCOPe 2.08, called d2a0ba_
View in 3D