SCOPe 2.06: Domain d2nlaa_: 2nla A:

Lineage for d2nlaa_ (2nla A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187917] (2 PDB entries)

8. Domain d2nlaa_: 2nla A: [166267]
   automated match to d1wsxa_

Details for d2nlaa_

PDB Entry: 2nla, 2.8 Å

PDB Description: crystal structure of the mcl-1:mnoxab bh3 complex

PDB Compounds: (A:) FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOPe Domain Sequences for d2nlaa_:

Sequence; same for both SEQRES and ATOM records:

>d2nlaa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhv

Timeline for d2nlaa_:

• d2nlaa_ first appeared in SCOPe 2.01
  
• d2nlaa_ appears in SCOPe 2.05
  
• d2nlaa_ appears in SCOPe 2.07
  
• d2nlaa_ appears in the current release, SCOPe 2.08