Lineage for d2nlaa_ (2nla A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955371Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)
  7. 1955380Species Norway rat (Rattus norvegicus) [TaxId:10116] [187917] (2 PDB entries)
  8. 1955382Domain d2nlaa_: 2nla A: [166267]
    automated match to d1wsxa_

Details for d2nlaa_

PDB Entry: 2nla (more details), 2.8 Å

PDB Description: crystal structure of the mcl-1:mnoxab bh3 complex
PDB Compounds: (A:) FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOPe Domain Sequences for d2nlaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlaa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhv

SCOPe Domain Coordinates for d2nlaa_:

Click to download the PDB-style file with coordinates for d2nlaa_.
(The format of our PDB-style files is described here.)

Timeline for d2nlaa_: