![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187917] (2 PDB entries) |
![]() | Domain d2nlaa_: 2nla A: [166267] automated match to d1wsxa_ |
PDB Entry: 2nla (more details), 2.8 Å
SCOPe Domain Sequences for d2nlaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nlaa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]} ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffhv
Timeline for d2nlaa_: