SCOPe 2.05: Domain d2nl9a_: 2nl9 A:

Lineage for d2nl9a_ (2nl9 A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187917] (2 PDB entries)

8. Domain d2nl9a_: 2nl9 A: [166266]
   automated match to d1wsxa_
   complexed with cl, zn

Details for d2nl9a_

PDB Entry: 2nl9, 1.55 Å

PDB Description: crystal structure of the mcl-1:bim bh3 complex

PDB Compounds: (A:) FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOPe Domain Sequences for d2nl9a_:

Sequence, based on SEQRES records:

>d2nl9a_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records):

>d2nl9a_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddlyrqsleiisrylreqatgsgaagrraletlrrvgdgvqrnhetafqgmlrkldikne
ddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvr
tkrdwlvkqrgwdgfveffhve

Timeline for d2nl9a_:

• d2nl9a_ first appeared in SCOPe 2.01
  
• d2nl9a_ appears in SCOPe 2.04
  
• d2nl9a_ appears in SCOPe 2.06
  
• d2nl9a_ appears in the current release, SCOPe 2.08