Lineage for d2nl9a_ (2nl9 A:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1695625Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1695694Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1695695Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1695790Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)
  7. 1695799Species Norway rat (Rattus norvegicus) [TaxId:10116] [187917] (2 PDB entries)
  8. 1695800Domain d2nl9a_: 2nl9 A: [166266]
    automated match to d1wsxa_
    complexed with cl, zn

Details for d2nl9a_

PDB Entry: 2nl9 (more details), 1.55 Å

PDB Description: crystal structure of the mcl-1:bim bh3 complex
PDB Compounds: (A:) FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOPe Domain Sequences for d2nl9a_:

Sequence, based on SEQRES records: (download)

>d2nl9a_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records): (download)

>d2nl9a_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddlyrqsleiisrylreqatgsgaagrraletlrrvgdgvqrnhetafqgmlrkldikne
ddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvr
tkrdwlvkqrgwdgfveffhve

SCOPe Domain Coordinates for d2nl9a_:

Click to download the PDB-style file with coordinates for d2nl9a_.
(The format of our PDB-style files is described here.)

Timeline for d2nl9a_: