SCOPe 2.01: Domain d2nl8a_: 2nl8 A:

Lineage for d2nl8a_ (2nl8 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)

6. Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)

7. Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)

8. Domain d2nl8a_: 2nl8 A: [166265]
   automated match to d1tbda_
   protein/DNA complex

Details for d2nl8a_

PDB Entry: 2nl8, 2.3 Å

PDB Description: the origin binding domain of the sv40 large t antigen bound non specifically to a 17 bp palindrome dna (sites 1 and 3)

PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d2nl8a_:

Sequence; same for both SEQRES and ATOM records:

>d2nl8a_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
edpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynh
nilffltphrhrvsainnyaqklstfsflickgvnkeylmysaltrdpfsvieeslp

Timeline for d2nl8a_:

• d2nl8a_ is new in SCOPe 2.01-stable
  
• d2nl8a_ appears in SCOPe 2.02
  
• d2nl8a_ appears in the current release, SCOPe 2.08