Lineage for d2nl8a_ (2nl8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963166Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2963167Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 2963174Species Simian virus 40, Sv40 [TaxId:10633] [55467] (10 PDB entries)
  8. 2963183Domain d2nl8a_: 2nl8 A: [166265]
    automated match to d1tbda_
    protein/DNA complex

Details for d2nl8a_

PDB Entry: 2nl8 (more details), 2.3 Å

PDB Description: the origin binding domain of the sv40 large t antigen bound non specifically to a 17 bp palindrome dna (sites 1 and 3)
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d2nl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nl8a_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
edpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynh
nilffltphrhrvsainnyaqklstfsflickgvnkeylmysaltrdpfsvieeslp

SCOPe Domain Coordinates for d2nl8a_:

Click to download the PDB-style file with coordinates for d2nl8a_.
(The format of our PDB-style files is described here.)

Timeline for d2nl8a_: