SCOPe 2.08: Domain d2l7hb1: 2l7h B:278-331

Lineage for d2l7hb1 (2l7h B:278-331)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.274: HAMP domain-like [158471] (1 superfamily)
   dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections

4. Superfamily a.274.1: HAMP domain-like [158472] (1 family)
   automatically mapped to Pfam PF00672

5. Family a.274.1.1: HAMP domain [158473] (2 proteins)
   Pfam PF00672

6. Protein Hypothetical protein AF1503 [158474] (1 species)
   C-terminal domain

7. Species Archaeoglobus fulgidus [TaxId:2234] [158475] (2 PDB entries)
   Uniprot O28769 278-331

8. Domain d2l7hb1: 2l7h B:278-331 [166264]
   Other proteins in same PDB: d2l7ha2, d2l7hb2
   automated match to d2l7ha_

Details for d2l7hb1

PDB Entry: 2l7h

PDB Description: The solution structure of the HAMP domain of the hypothetical transmembrane receptor Af1503

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2l7hb1:

Sequence; same for both SEQRES and ATOM records:

>d2l7hb1 a.274.1.1 (B:278-331) Hypothetical protein AF1503 {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame

Timeline for d2l7hb1:

• d2l7hb1 first appeared in SCOPe 2.01, called d2l7hb_
  
• d2l7hb1 appears in SCOPe 2.07