SCOPe 2.07: Domain d2kzna1: 2kzn A:1-143

Lineage for d2kzna1 (2kzn A:1-143)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.3: SelR domain [75041] (3 proteins)
   automatically mapped to Pfam PF01641

6. Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries)
   Uniprot P54155 1-143

8. Domain d2kzna1: 2kzn A:1-143 [166261]
   Other proteins in same PDB: d2kzna2

Details for d2kzna1

PDB Entry: 2kzn

PDB Description: Solution NMR Structure of Peptide methionine sulfoxide reductase msrB from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR10

PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrB

SCOPe Domain Sequences for d2kzna1:

Sequence; same for both SEQRES and ATOM records:

>d2kzna1 b.88.1.3 (A:1-143) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfds
qcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaa
lrfvpkhklkeegyesylhlfnk

Timeline for d2kzna1:

• d2kzna1 first appeared in SCOPe 2.01
  
• d2kzna1 appears in SCOPe 2.06
  
• d2kzna1 appears in the current release, SCOPe 2.08