Lineage for d2kzna1 (2kzn A:1-143)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407553Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2407554Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2407590Family b.88.1.3: SelR domain [75041] (3 proteins)
    automatically mapped to Pfam PF01641
  6. 2407595Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)
  7. 2407596Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries)
    Uniprot P54155 1-143
  8. 2407603Domain d2kzna1: 2kzn A:1-143 [166261]
    Other proteins in same PDB: d2kzna2

Details for d2kzna1

PDB Entry: 2kzn (more details)

PDB Description: Solution NMR Structure of Peptide methionine sulfoxide reductase msrB from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR10
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrB

SCOPe Domain Sequences for d2kzna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kzna1 b.88.1.3 (A:1-143) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfds
qcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaa
lrfvpkhklkeegyesylhlfnk

SCOPe Domain Coordinates for d2kzna1:

Click to download the PDB-style file with coordinates for d2kzna1.
(The format of our PDB-style files is described here.)

Timeline for d2kzna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kzna2