Lineage for d1dowa_ (1dow A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700098Protein alpha-catenin [47222] (2 species)
  7. 2700104Species Mouse (Mus musculus) [TaxId:10090] [47223] (3 PDB entries)
  8. 2700112Domain d1dowa_: 1dow A: [16626]
    chimera of the N-terminal domain of alpha-catenin and beta-catenin fragment (chain B)
    has additional subdomain(s) that are not in the common domain

Details for d1dowa_

PDB Entry: 1dow (more details), 1.8 Å

PDB Description: crystal structure of a chimera of beta-catenin and alpha-catenin
PDB Compounds: (A:) alpha-catenin

SCOPe Domain Sequences for d1dowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dowa_ a.24.9.1 (A:) alpha-catenin {Mouse (Mus musculus) [TaxId: 10090]}
kahvlaasveqatenflekgdkiakesqflkeelvvavedvrkqgdlmksaagefaddpc
ssvkrgnmvraarallsavtrlliladmadvykllvqlkvvedgilklrnagneqdlgiq
ykalkpevdklnimaakrqqelkdvgnrdqmaaargilqknvpilytasqaclqhpdvaa
ykanrdliykqlqqavtgisnaaqa

SCOPe Domain Coordinates for d1dowa_:

Click to download the PDB-style file with coordinates for d1dowa_.
(The format of our PDB-style files is described here.)

Timeline for d1dowa_: