![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) ![]() |
![]() | Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
![]() | Protein alpha-catenin [47222] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47223] (3 PDB entries) |
![]() | Domain d1dowa_: 1dow A: [16626] chimera of the N-terminal domain of alpha-catenin and beta-catenin fragment (chain B) has additional subdomain(s) that are not in the common domain |
PDB Entry: 1dow (more details), 1.8 Å
SCOPe Domain Sequences for d1dowa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dowa_ a.24.9.1 (A:) alpha-catenin {Mouse (Mus musculus) [TaxId: 10090]} kahvlaasveqatenflekgdkiakesqflkeelvvavedvrkqgdlmksaagefaddpc ssvkrgnmvraarallsavtrlliladmadvykllvqlkvvedgilklrnagneqdlgiq ykalkpevdklnimaakrqqelkdvgnrdqmaaargilqknvpilytasqaclqhpdvaa ykanrdliykqlqqavtgisnaaqa
Timeline for d1dowa_: