Lineage for d2k07a_ (2k07 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898667Family d.20.1.4: UFC1-like [143072] (2 proteins)
    automatically mapped to Pfam PF08694
  6. 1898668Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
    aka cgi-126
  7. 1898669Species Human (Homo sapiens) [TaxId:9606] [143074] (4 PDB entries)
    Uniprot Q9Y3C8 1-167
  8. 1898676Domain d2k07a_: 2k07 A: [166259]

Details for d2k07a_

PDB Entry: 2k07 (more details)

PDB Description: solution nmr structure of human e2-like ubiquitin-fold modifier conjugating enzyme 1 (ufc1). northeast structural genomics consortium target hr41
PDB Compounds: (A:) Ufm1-conjugating enzyme 1

SCOPe Domain Sequences for d2k07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k07a_ d.20.1.4 (A:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh

SCOPe Domain Coordinates for d2k07a_:

Click to download the PDB-style file with coordinates for d2k07a_.
(The format of our PDB-style files is described here.)

Timeline for d2k07a_: