![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.4: UFC1-like [143072] (2 proteins) automatically mapped to Pfam PF08694 |
![]() | Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species) aka cgi-126 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143074] (4 PDB entries) Uniprot Q9Y3C8 1-167 |
![]() | Domain d2k07a_: 2k07 A: [166259] |
PDB Entry: 2k07 (more details)
SCOPe Domain Sequences for d2k07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k07a_ d.20.1.4 (A:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
Timeline for d2k07a_: