Lineage for d2jv3a_ (2jv3 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493399Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 1493406Protein Ets-1 transcription factor pointed domain [47771] (1 species)
  7. 1493407Species Mouse (Mus musculus) [TaxId:10090] [47772] (1 PDB entry)
  8. 1493408Domain d2jv3a_: 2jv3 A: [166258]
    CASP3

Details for d2jv3a_

PDB Entry: 2jv3 (more details)

PDB Description: ets-1 pnt domain (29-138) nmr structure ensemble
PDB Compounds: (A:) ETS1 proto-oncogene

SCOPe Domain Sequences for d2jv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jv3a_ a.60.1.1 (A:) Ets-1 transcription factor pointed domain {Mouse (Mus musculus) [TaxId: 10090]}
mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef
slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk

SCOPe Domain Coordinates for d2jv3a_:

Click to download the PDB-style file with coordinates for d2jv3a_.
(The format of our PDB-style files is described here.)

Timeline for d2jv3a_: