SCOPe 2.04: Domain d2jv3a_: 2jv3 A:

Lineage for d2jv3a_ (2jv3 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Ets-1 transcription factor pointed domain [47771] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47772] (1 PDB entry)

8. Domain d2jv3a_: 2jv3 A: [166258]
   CASP3

Details for d2jv3a_

PDB Entry: 2jv3

PDB Description: ets-1 pnt domain (29-138) nmr structure ensemble

PDB Compounds: (A:) ETS1 proto-oncogene

SCOPe Domain Sequences for d2jv3a_:

Sequence; same for both SEQRES and ATOM records:

>d2jv3a_ a.60.1.1 (A:) Ets-1 transcription factor pointed domain {Mouse (Mus musculus) [TaxId: 10090]}
mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef
slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk

Timeline for d2jv3a_:

• d2jv3a_ first appeared in SCOPe 2.01
  
• d2jv3a_ appears in SCOPe 2.03
  
• d2jv3a_ appears in SCOPe 2.05
  
• d2jv3a_ appears in the current release, SCOPe 2.08