| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein automated matches [190545] (9 species) not a true protein |
| Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries) |
| Domain d2jkwb_: 2jkw B: [166252] automated match to d1bqka_ complexed with cu |
PDB Entry: 2jkw (more details), 1.6 Å
SCOPe Domain Sequences for d2jkwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jkwb_ b.6.1.1 (B:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgafvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn
Timeline for d2jkwb_: