Lineage for d2jkri_ (2jkr I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211132Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2211145Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)
    automatically mapped to Pfam PF01217
  6. 2211149Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)
  7. 2211150Species Mouse (Mus musculus) [TaxId:10090] [75525] (5 PDB entries)
  8. 2211152Domain d2jkri_: 2jkr I: [166249]
    Other proteins in same PDB: d2jkrb_, d2jkre_
    automated match to d1gw5s_
    complexed with so4

Details for d2jkri_

PDB Entry: 2jkr (more details), 2.98 Å

PDB Description: ap2 clathrin adaptor core with dileucine peptide rm(phosphos)qikrllse
PDB Compounds: (I:) ap-2 complex subunit sigma-1

SCOPe Domain Sequences for d2jkri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkri_ d.110.4.2 (I:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

SCOPe Domain Coordinates for d2jkri_:

Click to download the PDB-style file with coordinates for d2jkri_.
(The format of our PDB-style files is described here.)

Timeline for d2jkri_: