Lineage for d2jkre_ (2jkr E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006697Family a.118.1.10: Clathrin adaptor core protein [74771] (3 protein domains)
    automatically mapped to Pfam PF01602
  6. 2006704Protein automated matches [190425] (2 species)
    not a true protein
  7. 2006705Species Human (Homo sapiens) [TaxId:9606] [187313] (3 PDB entries)
  8. 2006707Domain d2jkre_: 2jkr E: [166248]
    Other proteins in same PDB: d2jkri_, d2jkrs_
    automated match to d1gw5b_
    complexed with so4

Details for d2jkre_

PDB Entry: 2jkr (more details), 2.98 Å

PDB Description: ap2 clathrin adaptor core with dileucine peptide rm(phosphos)qikrllse
PDB Compounds: (E:) AP-2 complex subunit beta-1

SCOPe Domain Sequences for d2jkre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkre_ a.118.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnlelkklvyl
ylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylceplrkclk
dedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaalseisesh
pnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicervtprlsha
nsavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyvalrninlivq
krpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvdfvr
kavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypnkyesiiat
lcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqltlltaivkl
flkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakevvlsekplisee
tdlieptlldelichigslasvyhkppnafv

SCOPe Domain Coordinates for d2jkre_:

Click to download the PDB-style file with coordinates for d2jkre_.
(The format of our PDB-style files is described here.)

Timeline for d2jkre_: