Lineage for d2jkqa_ (2jkq A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1042935Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1042936Species Chicken (Gallus gallus) [TaxId:9031] [187336] (2 PDB entries)
  8. 1042937Domain d2jkqa_: 2jkq A: [166246]
    automated match to d1mp8a_
    complexed with vg8

Details for d2jkqa_

PDB Entry: 2jkq (more details), 2.6 Å

PDB Description: focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2jkqa_:

Sequence, based on SEQRES records: (download)

>d2jkqa_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Chicken (Gallus gallus) [TaxId: 9031]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapes
infrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlys
lmtkcwaydpsrrprftelkaqlstileeeklq

Sequence, based on observed residues (ATOM records): (download)

>d2jkqa_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Chicken (Gallus gallus) [TaxId: 9031]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglslpikwmapesinfrrftsasdvwmf
gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
ftelkaqlstileeeklq

SCOPe Domain Coordinates for d2jkqa_:

Click to download the PDB-style file with coordinates for d2jkqa_.
(The format of our PDB-style files is described here.)

Timeline for d2jkqa_: