Lineage for d2jkma_ (2jkm A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674005Species Chicken (Gallus gallus) [TaxId:9031] [187329] (6 PDB entries)
  8. 1674010Domain d2jkma_: 2jkm A: [166244]
    automated match to d1mp8a_
    complexed with bii

Details for d2jkma_

PDB Entry: 2jkm (more details), 2.31 Å

PDB Description: focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2jkma_:

Sequence, based on SEQRES records: (download)

>d2jkma_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
alayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmape
sinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptly
slmtkcwaydpsrrprftelkaqlstileeeklq

Sequence, based on observed residues (ATOM records): (download)

>d2jkma_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
alayleskrfvhrdiaarnvlvssndcvklgdfglsrlpikwmapesinfrrftsasdvw
mfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrr
prftelkaqlstileeeklq

SCOPe Domain Coordinates for d2jkma_:

Click to download the PDB-style file with coordinates for d2jkma_.
(The format of our PDB-style files is described here.)

Timeline for d2jkma_: