Class g: Small proteins [56992] (98 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein BIR domains of XIAP [57928] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries) Uniprot P98170 241-356 |
Domain d2jk7a_: 2jk7 A: [166240] automated match to d1f9xa_ complexed with bi6, zn |
PDB Entry: 2jk7 (more details), 2.82 Å
SCOPe Domain Sequences for d2jk7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jk7a_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} fpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltd wkpsedpweqhakwypgckylleqkgqeyinnihlth
Timeline for d2jk7a_: