Lineage for d2jk0h_ (2jk0 H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142708Protein automated matches [190446] (8 species)
    not a true protein
  7. 2142754Species Pectobacterium carotovorum [TaxId:554] [188521] (1 PDB entry)
  8. 2142762Domain d2jk0h_: 2jk0 H: [166239]
    automated match to d1hfja_
    complexed with asp

Details for d2jk0h_

PDB Entry: 2jk0 (more details), 2.5 Å

PDB Description: structural and functional insights into erwinia carotovora l-asparaginase
PDB Compounds: (H:) L-asparaginase

SCOPe Domain Sequences for d2jk0h_:

Sequence, based on SEQRES records: (download)

>d2jk0h_ c.88.1.1 (H:) automated matches {Pectobacterium carotovorum [TaxId: 554]}
nlpnivilatggtiagsaaantqttgykagalgvetliqavpelktlanikgeqvasigs
enmtsdvlltlskrvnellarsdvdgvvithgtdtldespyflnltvksdkpvvfvaamr
pataisadgpmnlygavkvaadknsrgrgvlvvlndrigsarfisktnastldtfkapee
gylgviigdkiyyqtrldkvhttrsvfdvtnvdklpavdiiygyqddpeymydasikhgv
kgivyagmgagsvskrgdagirkaeskgivvvrssrtgsgivppdagqpglvadslspak
srillmlaltkttnpaviqdyfhay

Sequence, based on observed residues (ATOM records): (download)

>d2jk0h_ c.88.1.1 (H:) automated matches {Pectobacterium carotovorum [TaxId: 554]}
nlpnivilatggtiagsgalgvetliqavpelktlanikgeqvasigsenmtsdvlltls
krvnellarsdvdgvvithgtdtldespyflnltvksdkpvvfvaamrpataisadgpmn
lygavkvaadknsrgrgvlvvlndrigsarfisktnastldtfkapeegylgviigdkiy
yqtrldkvhttrsvfdvtnvdklpavdiiygyqddpeymydasikhgvkgivyagmgags
vskrgdagirkaeskgivvvrssrtgsgivppdagqpglvadslspaksrillmlaltkt
tnpaviqdyfhay

SCOPe Domain Coordinates for d2jk0h_:

Click to download the PDB-style file with coordinates for d2jk0h_.
(The format of our PDB-style files is described here.)

Timeline for d2jk0h_: