Lineage for d2jjyd_ (2jjy D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843166Species Francisella tularensis [TaxId:263] [188795] (1 PDB entry)
  8. 2843170Domain d2jjyd_: 2jjy D: [166231]
    Other proteins in same PDB: d2jjya2, d2jjyb2, d2jjyc2
    automated match to d1c14a_
    complexed with nad

Details for d2jjyd_

PDB Entry: 2jjy (more details), 2.9 Å

PDB Description: crystal structure of francisella tularensis enoyl reductase (ftfabi) with bound nad
PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d2jjyd_:

Sequence, based on SEQRES records: (download)

>d2jjyd_ c.2.1.2 (D:) automated matches {Francisella tularensis [TaxId: 263]}
gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
ikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgit
gevvhvdagyhcvsmgnvl

Sequence, based on observed residues (ATOM records): (download)

>d2jjyd_ c.2.1.2 (D:) automated matches {Francisella tularensis [TaxId: 263]}
gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
ikvnavsagpikmldynamvsplkknvdimevgntvaflcsdmatgitgevvhvdagyhc
vsmgnvl

SCOPe Domain Coordinates for d2jjyd_:

Click to download the PDB-style file with coordinates for d2jjyd_.
(The format of our PDB-style files is described here.)

Timeline for d2jjyd_: