Lineage for d2jj6a_ (2jj6 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 945308Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 945309Protein automated matches [190437] (11 species)
    not a true protein
  7. 945336Species Human (Homo sapiens) [TaxId:9606] [187655] (21 PDB entries)
  8. 945371Domain d2jj6a_: 2jj6 A: [166212]
    automated match to d1bkza_

Details for d2jj6a_

PDB Entry: 2jj6 (more details), 2 Å

PDB Description: crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
PDB Compounds: (A:) galectin-related protein

SCOPe Domain Sequences for d2jj6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj6a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqll
rnscisgergeeqsaipyfpfipdqpfrveilcehprfrvfvdghqlfdfyhriqtlsai
dtikingdlqitkl

SCOPe Domain Coordinates for d2jj6a_:

Click to download the PDB-style file with coordinates for d2jj6a_.
(The format of our PDB-style files is described here.)

Timeline for d2jj6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jj6b_