SCOPe 2.07: Domain d2jikb_: 2jik B:

Lineage for d2jikb_ (2jik B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)

8. Domain d2jikb_: 2jik B: [166210]
   automated match to d1qlca_

Details for d2jikb_

PDB Entry: 2jik, 1.35 Å

PDB Description: crystal structure of pdz domain of synaptojanin-2 binding protein

PDB Compounds: (B:) synaptojanin-2 binding protein

SCOPe Domain Sequences for d2jikb_:

Sequence, based on SEQRES records:

>d2jikb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smdylvteeeinltrgpsglgfnivggtdqqyvsndsgiyvsrikengaaaldgrlqegd
kilsvngqdlknllhqdavdlfrnagyavslrvqhrlessi

Sequence, based on observed residues (ATOM records):

>d2jikb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smdylvteeeinltrgpsglgfnivggtdqqydsgiyvsrikengaaaldgrlqegdkil
svngqdlknllhqdavdlfrnagyavslrvqhrlessi

Timeline for d2jikb_:

• d2jikb_ first appeared in SCOPe 2.01
  
• d2jikb_ appears in SCOPe 2.06
  
• d2jikb_ appears in the current release, SCOPe 2.08, called d2jikb1